Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

December 08 2013

thatsridicarus
9212 4b16

mrscriss2012:

This is my son, Chester, who is nearly 4. He was invited to his friend Chloe’s birthday party today, the theme was prince and princesses. He asked if he could go as Sleeping Beauty, so I bought him a dress and put a cute little clip in his hair.

We arrived at the party to the following comments from the adults present:
“Oh that is just cruel.”

"Why did you make him wear a dress?"

"Poor little man, what’s your mummy playing at?"

"He’s going to hate you when he grows up."

"No way I’d let my son dress like a girl."

The fact is, Chester is almost completely gender neutral. I let him wear what he wants, be it boys or girls clothes, and he plays with whatever toys he likes. This usually involves him holding tea parties while wearing his pink Minnie Mouse top, jeans and a tiara. The guests are more often than not a mixture of Winnie The Pooh characters, dinosaurs, Barbie, Dora and solders, and they’re usually transported in his favorite fire engine.

When my husband arrived at the party later on, he was subjected to endless ridicule from the other dad’s present about how I must keep his balls in my back pocket because otherwise he would have put his foot down and not allowed Chester out like that. Oh, and by the way, our other son dressed as Ariel. When my husband pointed out that the boys were happy, and the mother of the birthday child made a point of saying how wonderful she thought it was that we allowed them freedom of choice and expression, they then stopped talking about it to our faces and started muttering about us behind our backs.

Interestingly enough, not a single child said a word about their choice of costumes, other than to compliment Chester on his new dress.

Reposted bypannakojotzooziastragglerim-so-retarded9-smerfnych-myslibesenmanxxlordminxwrite-url-herelost-in-spacemajakblondasbradypusbansheevangelynvertheermishastanevermorefuckitbuffyrulezmichalinaxFreXxXpesymistaotsanamahsheedniceshotarabusdanielbohrercanthugeverycatmalpankatinexapatycznaLifelineableduartenleftandrightstraycatpulegonsplinterpieStadtgespenstBloodredswanwerhamstermrc-hllsfarthenhahatschaafoscariohoernchenkotzeshiaraenacoffeebitchnibotdivineunundneunzigMissPunchlinechronkompotzescierkijotcce

October 01 2013

thatsridicarus

August 22 2013

thatsridicarus
4394 4392 500

kaiaminalcrossing:

Today was a really fantastic day.

A while back I had the thought, “I wish I could buy all my friends a 3DS and a copy of Animal Crossing.” The more I thought about it, the more I believed it wasn’t something out of my reach. I did a little bit of saving up and made enough to make it happen.

Tea, desserts, and Animal Crossing with four of my favorite people in the world. I had a really good day.

(via lucineblue)

Reposted bymolotovcupcakeniekoniecznieomnieRekrut-Knaichune-raconteuseemciufrittatensuppech2terpanibozenawonderlustqueenspinatlasagnePapsTpiratka-wariatkaavaritiaTheYaibaOtacon32ZuruimacounNeruzalTaihoumonimichhavoc00KryptoniteCatChiVarjoaValkyrieWendolitos

August 08 2013

thatsridicarus
Reposted byfadenbAgnesfabzfiffeycellAnilorak18anabeeJoschIsAGeekasiekxpFPagehay1989fafnirscaveteijakoolgerdistanzideshowbobrainbowzombieskilledmyunicornMissDeWordeDerOrwischerskizzomuertoMorgulpiniataClubtimmayhavoc23zizzqikPedoP4ndaieffoobarbazAgainstrealityfnordpadreloveutionelektronowyreloveutionpanda3koniniedopowiedzeniaankinkanikaninaichlossosakashrinkaformaldehydSapereAudeaviee

July 18 2013

What's your favorite party game?

That game where we punch each other in the face while being drunk on soda or high from snorting Nerds crack.
Tags: ask.fm party game

July 14 2013

thatsridicarus
#ThatWouldBeCoolToo oh anna
(via Cheezburger)
Reposted bynaichmacounzhawkiemarvellousmecoloredgrayscalevolldostTeenageDirtbagstraycatAryessDerOrwischerchoEruesterielwandiMrCoffesuesssauerfoxgallagherlossosyouamgabrysiowakadreipaulinabn0gniekoniecznieomniePachadi

July 07 2013

thatsridicarus
DabbleRama - IDEO

July 02 2013

thatsridicarus
Reposted bygifluvim-so-retardedkamlotpartyTeereajabolmaxReisagainstpkz451CurumomonimichPorcelaincojapaczethemasterofhamsterpulegonjestnamdzisiajsmutnodotmariuszhurtowniazwirukukawilczajethrapomoorsleeplessdiarypralineNayuretWekskasiazuairokichigaibiiancakartoNikpanibozenazerocool911lili1234Pigsszabatowafancy-clapszoraxsoadystapartyhardorgtfoSoulPLMaR2-D2moppieulaPinkCoffeemalinkofffaimpostercongrevedieselmowernodoprawdykoskossBecauseBoobsitsaccurateaddnowtoherefornowhereckisbackifinksonocnatesciowaandrewmylesamarusludwisli-la-leniThegleektoniewszystkogazdaebutinexciciktastewordspodpalaczkaduszczarnefantazjemoda24157soupandapuella13kyszzno-rush

June 05 2013

thatsridicarus

May 15 2013

thatsridicarus
Ni juu ni sai, ni juu ni, ni juu ni, ni juu ni,
Ore wa, ore ni juu ni sai furisodeshon.

HA I'm basically 15
Just because it's my birthday today. Also, I never actually thought the theme's gonna be Furisodeshon by Kyary Pamyu Pamyu watch the music video to get the reference
thatsridicarus
thatsridicarus
Typical college life
Reposted bygifluvmajakprincess-carolynisnojnnanotforgetmebluestarDarkDreamBincsmumre20wrzesniaedgithsadworldtobecontinuedcatchbreathoflifeihonoratamefirMartakTammybizarreriebetterthanliessiostralillepuppetpositanoolawieterazinherownwaymonimichpijanapowietrzemDiviusJurysekTygrysekletsgodrinktogethervogelFromMyInteriorgrouchywertherpannanboseynotorious-rookiePrzerwanalekcjamuzykijoannabfearofloveliveattherainbowthe-devileverybodywantstobeuslatuseklaocultaglupiasukaoktawiiasatanlovesmeemilyyAdonis17minutKacSousseblaxkseoulzielone-bananyKotokoinsanedreamerbananastildereasonscanneverwinnoonecaresanomaliacinnamon-lattemargooastedwaekamiilaapapilarna

May 10 2013

thatsridicarus
thatsridicarus

sailortwerk:

when people try to force me to socialize

(via underronesky)

Reposted bygifluvschaafemciukoniKryptoniterocknrollqueencieszesieboringsoupmolotovcupcakekonotorithesilenceofthealcoholicmkaynoagazdaKurkaWyluzujkornmaedchenavaritiagaborglupiasukamatusskatastrofoVelvetpawReisagainstcarlandlouiseRecklessKidhessicajughesinsanedreamerusagiimurdercuterapeMigotliwapartyhardorgtfomanuleinblahkayurafiiBincsmdelRayokahaluvbrianstormDarkDreamPulszooziasbguysblaxkseoullinandrilladerpderpderpniewychamowaneeissaycherrytomorrowkodokudefying-gravitymarvellousblackmoth7halyscircuspantadeuszmakingmoviesczeresniebloodywristsanimeacidevildoro456lubiezoltyalbognijfrogaholicpeculiar-catsannAndii-VwonderlustqueensiriusminervacorniskerosinehahatberrydragonnancymikkelsennanamisucznikgnoccoorchilazapachsianapiranianoemusialkefuckyoulittleszaaatanCurumokeriohalszka12makemewannadiecalifornia412lolazupkalightmonimichthosecookiesareminedariannnabuniairokichigaiLazhwardorangeugarteolalaabeatravelernotatouristleyrerjestemnanievolviolette-endivienebupesymistalittledarlingtrapmktoryprzezylpogowrajtszyderaBloodMooncojapaczezarazwracamnelabaibiiancadrumkarololeyovskalittleproblemkartoNiksniezkaTeenageDirtbagsuicidelandscapefancy-clapspathetic8fluorescentadolescenthonigwurmwrobelekmariolafascinatedsmoothhhhinspirationsmoritazaganskyavocadotreepmgjustpartofmelittlegreygirlcaligulatocoulotnesvndeadlysinsto-nieistotneloozikerthatneverhappenedburialtuffMrWaspf4m8Herbatoholiczkafrittatensuppebet91stragan-ze-snamipimpmyheartalotlikevegasryskaPolindainyoudoesntsaysomethingethielK8trustno1iamnotarobotterazEegzystencjalnypawlarwyastralnemonroewiecznamonroemakemewannadieKotokosaintsandnanapushbadalenaMaR2-D2klapkitry2beunusualfiligranovaaffiaRaichukarolinnaatickimickihisteramargoodawnodawnotemuwiecejniezobaczyszlexxielittledinapathetic8longvomitingagta13myloveaynisfearoflovenienawidzeludzimigotkagniewosadkaiammoodytak-czekamkillyourherouskidsknowantoninaveritas1emmaleadbrianstormgeek4lifefafnirscaveboobiMrWaspmonimichmissmadeleineAdikTheOnesputniksweetheartunenlaaaksoNiveaCowsluttypumpkinmrymrumruIhezaladmnbewarenodoprawdywaitingfortheguidecukierekkatastrofodzonybakanojoouberenikaaventineklodshitty-lovefluorescentadolescenti-the-wildbawelnianagoraca-czekoladajazzujfafnirscaveDerOrwischerbufkablahWeksKatSoulczekoladowezatraceniecaptaincruncheskapizahysteryczkahplovecraftnocnatesciowawybuchmuzguepidemicsippinglife

May 01 2013

thatsridicarus

lyriumspirit:

I adore the way Ice King says party.

April 22 2013

thatsridicarus
Margaret - Thank You Very Much
This is the downside of having nudist parents & relatives

April 21 2013

thatsridicarus

January 12 2013

thatsridicarus
quasiwhitegirl:

so I’m trying to study, but I keep getting distracted by this acetylcholinesterase enzyme because it just looks like it’s having so much fun

image

every time I switch tabs it’s like BAM SURPRISE ENZYME PARTY

Nobody parties like enzymes
Reposted byOrangeandwhiteOleanderrazorbladeshumer1213

January 01 2013

thatsridicarus
Reposted byzooziaallyouneedissoupskomplikowaniekaterprzytulankiSic616panafaxkumikoihearvoicesemciuuncoorestesgaolinmalinowykisielAlekwasmonimichbiiancaMorgulmisery000repostedfromskrzfridgeno-longer-korebirthday-songsomebunnyzapalenieosierdziamrautynamakingmoviesmaraskowaeffodienssepulcrumdeathisjustafeelingwhodarefloorencemagdulumtwicekilkaobsesjiwelocypedbedazzlementcuilwarthien666wawuschelcrystalllperkelewodolankashampainkocikapucbrovinskywaitingfortheguideredheadladybudasburakotkamamadynia84kabliukainelafbeltane9thoctobersstefaniawellanuszkaastedwae60Bczleksobotnithe-new-beyonceenishafutureiscomingmalvaeslovabawelnianagralakowaczeresniemuminulsmigamyniesmiertelnabrzoskwinkacricettalatusekMaR2-D2czachadymimozgmnieniebolizombiktamaraffeszczerbatyszczurekblyskcheshiresmilemariMonirvana27666windingroadsmariolaarachnephobiclifeesilimaginarykeithpeligrobagherawerandaafryatkalongvomitingchangemylifegrandmatru-skawkapeppafatuune-raconteusehomoludensred-trainerszielonomonimichlajlalajlalajlatildeCrazyAntinsanedreamertakemeoutpannankumikouskidsknowpudddingnevermorefuckitWekskasiulaRekrut-Kilovegreenmoominspeculiar-catnattalymrdonadoniigniewosadkatoniewszystkoDieKleineMyiammoodyezermalinowykisielgeraltbiscuitteisnotcominghomebawelnianamariolabloodywristssamozatruciearachnephobictoxicsoulMeeresbrautbradypuseldriannecaptainsebrasfetersomethingstupidcheshiresmilejointskurwysynsomebunny666thlongvomitingcholerabangbangyouredeadumierankofrauvermeer

December 23 2012

thatsridicarus
September House & Garden part 3.
Pink & green are pretty.
Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!

Schweinderl