Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

June 02 2015

thatsridicarus

April 14 2015

thatsridicarus
Artist Turns Old Keys And Coins Into Recycled Art, Moerkey
Reposted fromSpecies5618 Species5618 viaWinterwarez Winterwarez

January 07 2015

thatsridicarus

September 05 2014

thatsridicarus

July 29 2014

thatsridicarus
1265 fac8
Reposted byPorcelainschaafsanczog33kyKrschtschnveronica-orateknaichlikewaterfallcorppneqkarrolkaedhellrandomusercoloredgrayscalezaduzonarazWeksfinkreghfionaandcakeVermillionfrogaholicdzonyciarkalatheav2pxevangelynablhederemushumikmikmikteaholicdrink-milkrurkyholamasdosmoke11HypothermiaDeactivatedpankamiendrseilzugsmoczejnatexwtfpanteraTomred97lambdafrywolitkasofastgdziemitupomokrymbumblebeeeirenashitty-lovelolufoblondithor7ovolhappykokeshiSengamarbearjeyjeyjeyohhhWarxuarozgaabutomashBincsmshiaraenafreewayshampainlesatyreSpecies5618glupiasukavogelinayabananowoim-so-retardedsucznikkocikapucmidajJulietteCaptain-ChaosrocknrollqueenweirdnikkrybusMlaskdarkcandykasiarzynatrikkwd40stopssqueaksadremhahatCatLovesRiceAMcKzoraxconsensualnonconsentgetstonedsabvelqzpuszczykShingomurch2ternoisetaleskatzenpongjaerkachaianatexhurraFroggyRethanblindtextschlachtorosJoschIsAGeekKurkaWyluzujarachnephobicBloodyYukiweirdscenesinsidethegoldmineogharipouridl3xh0p3write-url-hereprojectmayhemv3bsomischgaLithieukamakamawhovilleznottismall-town-girlpyrrhoneduartentotal1tywerhamsterolgushjalokim0cocciuellamurzyn44achikueirenacocciuellaikarihappykokeshiserenitekamykowataLuukkagoszkorickympwrite-url-herepanpancernyseveraksofiasmr-absentiastraycatleniwabulaablinzynierzupamarzenLykouschottladenwujcioBat8agiennyRedPennyp856

July 23 2014

thatsridicarus

July 22 2014

thatsridicarus

July 06 2014

thatsridicarus

June 23 2014

May 06 2014

thatsridicarus
2074 71fb 500
Reposted byunicornwantedJagotenpannakojotandrewmyleskartoNikpoem-orgyKurkaWyluzujPaniMinisterCurumokasiakmehhh

April 26 2014

thatsridicarus

January 08 2014

thatsridicarus
2007 5f1c
"Look at that apple. It's me."
Reposted byalfredowybamboszlockeskogsadmnasphantixambassadorofdumbrugiaSakerosTheOtherRugiamrpafusagiSteinkauzluckashekRESERECTTORTomred97ovenorenterthevoidhimerraconchigliafaguss

November 12 2013

thatsridicarus

figgyloo-pudding:

pokemonyewest:

lampsarepeopletoo:

what the

Nothing beats a snow pentagonal dodecahedron

I quit

Reposted byihearvoiceslost-in-spacenie-ma-zupy

November 10 2013

thatsridicarus
6756 0923

friendlyneighborhoodblendermann:

bullshit394:

thernediocregatsby:

darkfather-ihavesinned:

stfunadeen:

hisan-na:

orientaltiger:

Fill your heart with secrets but the only way to read them is if you break your heart. 

i will forever reblog this

i need me one of these.

OMG I WANT ONE

i think every couple should get one and fill it with the little things they love about each other. and then if they’re fighting throw it at a wall and read all the little things that come out and hopefully that will remind them to love again. 

asdfghjkl reblogging for that ^

^Yes.

Reposted byniktwaznyadhara

November 04 2013

thatsridicarus
thisiscolossal:

An Aerial Kinetic Sculpture with 256 Helium Balloons Embedded with LEDs

Cyclique was an aerial light and sound installation created by audiovisual artist Nohista and Collectif Coin forNuit Blanche 2013 (previously). The array of 256 large white balloons was embedded with LEDs that blinked in sequence with various audio tracks and was further enhanced by the impact of wind which altered the layout and motion of the piece.
Reposted bytrafopop trafopop

November 02 2013

thatsridicarus

12temples:

Lei Xue, Porcelain Soda Can.

(source: Neatorama via timidkoala)
Reposted bykartoNikihearvoicesankinbykurulzDarkDreammanxxsleeplessdiarymolotovcupcakeJoschIsAGeekbinamarbearKudlatyBluesatrantakatastrofomahsheedvertheerberabirszasignalpiedidlirnikvaillanceAbbieandtheAbyssmalinowowatickimickibicietwegosercavampiranikamtildewishyouwerehereloveisadogfromhellcynamonMellypotrzaskkotkotkotkotkotpsychocukierwastelandpannaxpuszkaszyderaoxygeniumklaudiavstheworldveronica-owonderlandsoooucover-my-eyesheart-shapedanythingmyinspirationjrblowglowflowczeresniejaskierbojaniewiempuella13chmiel66
thatsridicarus
Soo Sunny Park (b. Seoul, Korea) - Unwoven Light at Rice University’s Rice Gallery in Houston, Texas.
Reposted bytawmolotovcupcakeniceone

October 28 2013

thatsridicarus
4649 7799

wetheurban:

ART: ‘Melting Men’ by Nele Azevedo

In 2009 Brazilian artist Nele Azevedo carved 1,000 ‘Melting Men’ out of ice and placed them in Berlin’s Gendarmenmarkt Square to bring awareness to Global Warming.

Read More

Reposted byblyskrugianodoprawdylockesgeek4lifeihearvoicespasazerthosecookiesareminewishyouwereheretbtfspaceshipskr-likdesoleessteemciubirrchjstrblmescalineambassadorofdumbditzybruschettazizzliwqpampamnaszeniceshotetamjogipaaammicarosetoniewszystkobumiphotochmiel66rudoscigemusiasratytatymonjurkakatarynkaredsunrisepreludiummietaune-raconteusewellAgnieszkaCKblyskbalbinaatramentovvaLuukkapikseledobbymissyseepytrawkaaawiecejniezobaczyszKACHAPinkpillsecrivainwakemeupxnevermorefuckitpinggwinwhattevermarvelaxarosraroChlodnaKrystynaancykthefirstdropotfedtristesannlikushkaisorainyhappinessKurkaWyluzujkfiationa-77angeliqueeWonderWoman13malinysieskonczylysrslysavordum-spiro-speromagdanestor11amatenawrednaadamskilyzeczkalaocultablymsienszczerbatyszczurekskizzoMissDeWordecheathadanielbohrerberlinjobistraycateredvarethloveisadogfromhellschlachtorosapersonInsliagaypreacherwariactwoderpderpderpRESERECTTORniklashmmmnnreloveutionatrantasmoczejszpaqusloozikerthe-new-beyoncebladzikmonkeyheadtekwojkokolokokatastrofohardkorweystragglermiakichocolatekittenwithmyheadinspacebeltaneblondilamiastaMissySleepyzoraxchybakpiszpuszkahedereeatpuddinggdieselmoweroxygeniumbabcialiteon44amalczeresnieBarcarollawstawieplywaizabasienazywamareknelskieirenaknackigerapfelszczygielnorwegiansailorlesaphinapglogoredemptionsongsPawelSredwonderdol-blathannazoounoinacoverdantforcecalavadesoidreamofzepproksannindieaningeraltinfimitebloodymilkbufkasentymentycehtermegiddovlmandziarapannaxcoolekuhSenyiabuffyrulezmajkeytinexniedoskonaloschaptas

October 10 2013

thatsridicarus
9457 3f65
(Source: unknowneditors)
Tags: sculpture art
Reposted byhappykokeshi happykokeshi

October 08 2013

thatsridicarus
2919 e2bc

thegameisalife:

Mientras tanto, en algún lugar de España…

Meanwhile, in Spain…

@kitchen Oh hey look, the default Soup avatar! Now available in red.
Reposted bymanxxsignalpiecontinuesellerieprimevalanabeelordminxgruetzefadenbmetafnordbananaappleKryptoniteSmigolekeliasdaswarkeinhuhnlossoskatzenpongsqampyhanseiambabsifrittatensuppemczonksm0k1nggnuschlachtorosfnk4FreXxXWeksmoopreloveutionsstefaniaTheYaibaeduartengeek4lifeInspirationpoolaranjaegerdanielbohreracidsicksinckisbackkr-likHigh-Keyzarazwracambarricadedrink-meslovavogelrunkensteinlayriceballflederrattiecyronisecblackwujcioBatsofiascoloredgrayscalelockesnoirfaerysfinkreghDTDSRbeenoisev2pxantihecapertureFreXxXschaafsucznikEvilSadnessobermaexbiospunishercarfreitagmazzoolofiReeshTHE6radaetykiTycjadramaturgminderleisterlinsenoniegadajdiviTiffanyswheresthefoodCordeliaAutumzigafstrubbllyneradhoopcodingmonkeyurbanarttishkapannanmurdeltaEineFragevonStilqbu-ditkellerabteilfadenbJoschIsAGeekkittykatzenaichschlachtorosfightlingdesikarakachanowselen34DTDSRselen34vairalubi
Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!

Schweinderl