Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

October 01 2013


August 22 2013

4394 4392 500


Today was a really fantastic day.

A while back I had the thought, “I wish I could buy all my friends a 3DS and a copy of Animal Crossing.” The more I thought about it, the more I believed it wasn’t something out of my reach. I did a little bit of saving up and made enough to make it happen.

Tea, desserts, and Animal Crossing with four of my favorite people in the world. I had a really good day.

(via lucineblue)

Reposted byVarjoaValkyrieWendolitosmonimichmolotovcupcakeniekoniecznieomnieRekrut-Knaichune-raconteuseemciufrittatensuppech2terpanibozenawonderlustqueenspinatlasagnePapsTpiratka-wariatkaavaritiaTheYaibaOtacon32ZuruimacounNeruzalTaihouhavoc00KryptoniteCatChi

August 08 2013

Reposted byieffoobarbazzizzMissDeWordepiniataClubreloveutionankinakashqikelektronowyniedopowiedzeniareloveutionpanda3kanikanirinkanaichlossosSapereAudeavieegerdistanfadenbAgnesfabzfiffeycellAnilorak18anabeeJoschIsAGeekasiekxpFPagehay1989fafnirscaveteijakoolzideshowbobrainbowzombieskilledmyunicornDerOrwischerskizzomuertoMorgultimmayhavoc23PedoP4ndaAgainstrealityfnordpadkoniformaldehyd

July 18 2013

What's your favorite party game?

That game where we punch each other in the face while being drunk on soda or high from snorting Nerds crack.
Tags: ask.fm party game

July 14 2013

#ThatWouldBeCoolToo oh anna
(via Cheezburger)
Reposted bycoloredgrayscaleAryesswandimarvellousmeTeenageDirtbagnaichmacounzhawkievolldoststraycatDerOrwischerchoEruesterielMrCoffesuesssauerfoxgallagherlossosyouamgabrysiowakadreipaulinabn0gniekoniecznieomniePachadi

July 07 2013

DabbleRama - IDEO

July 02 2013

Reposted byczarnefantazjetinexcicikmonimichpomoorpralineNayulili1234zoraxpartyhardorgtfouladieselmowerThegleekirokichigaigifluvim-so-retardedkamlotpartyTeereajabolmaxReisagainstpkz451CurumoPorcelaincojapaczethemasterofhamsterpulegonjestnamdzisiajsmutnodotmariuszhurtowniazwirukukawilczajethrasleeplessdiaryretWekskasiazuabiiancakartoNikpanibozenazerocool911Pigsszabatowafancy-clapssoadystaSoulPLMaR2-D2moppiePinkCoffeemalinkofffaimpostercongrevenodoprawdykoskossBecauseBoobsitsaccurateaddnowtoherefornowhereckisbackifinksonocnatesciowaandrewmylesamarusludwisli-la-lenitoniewszystkogazdaebutastewordspodpalaczkaduszmoda24157soupandapuella13kyszzno-rush

June 05 2013


May 15 2013

Ni juu ni sai, ni juu ni, ni juu ni, ni juu ni,
Ore wa, ore ni juu ni sai furisodeshon.

HA I'm basically 15
Just because it's my birthday today. Also, I never actually thought the theme's gonna be Furisodeshon by Kyary Pamyu Pamyu watch the music video to get the reference
Typical college life
Reposted bykamiilaagifluvprincess-carolyntobecontinuedpositanosatanlovesmetildemargooglupiasukalaocultaemilyy17minutinsanedreamerlatusekoktawiiablaxkseoulastedwaepapilarnamajakisnojnnanotforgetmebluestarDarkDreamBincsmumre20wrzesniaedgithsadworldcatchbreathoflifeihonoratamefirMartakTammybizarreriebetterthanliessiostralillepuppetolawieterazinherownwaymonimichpijanapowietrzemDiviusJurysekTygrysekletsgodrinktogethervogelFromMyInteriorgrouchywertherpannanboseynotorious-rookiePrzerwanalekcjamuzykijoannabfearofloveliveattherainbowthe-devileverybodywantstobeusAdonisKacSoussezielone-bananyKotokobananasreasonscanneverwinnoonecaresanomaliacinnamon-latte

May 10 2013



when people try to force me to socialize

(via underronesky)

Reposted bydawnodawnotemuKatSoulczekoladowezatracenieeskapizanocnatesciowawybuchmuzguwiecejniezobaczyszlexxielittledinaNiveaCowadmnmrymrumruIhezalbewaredzonybakanojoounodoprawdywaitingfortheguidecukierekkatastrofopathetic8bawelnianagoraca-czekoladajazzujfafnirscaveDerOrwischerbufkablahWeksberenikaaventineklodshitty-lovefluorescentadolescentfearoflovenienawidzeludzigifluvthesilenceofthealcoholicKurkaWyluzujVelvetpawkayurafiibrianstormniewychamowaneecherrytomorrowderpderpderpszaaatannoevoltrapmktoryprzezylpogouskidsknowEegzystencjalnypawaffiaRaichusluttypumpkini-the-wildcaptaincrunchepidemicwonderlustqueenemciutuffReisagainstmatusspiraniaiamnotarobotkatastrofololaf4m8california412beatravelernotatouristMrWaspfuckyoulittlePolindaberrydragonmusialkegnoccoleyrernanamiinspirationskerosinezupkalightKryptoniteoleyovskaschaafAndii-VsannterazsmoothhhhjestemnanieinyouburialkartoNikzarazwracamrocknrollqueensiriusminervaNocephyahessicajughescornisviolette-endiviendariannnaebuzapachsianaolalaamonimichmolotovcupcakeorchilaRecklessKidK8ryskakeriobuniaorangeugartejustpartofmepathetic8makemewannadieboringsoupsuczniklarwyastralnethosecookiesaremineCurumoalotlikevegasnancymikkelsenstragan-ze-snamiklapkikarolinnaaiammoodyaynisagta13mylovetickimickilongvomitinggniewosadkamigotkakillyourheroAdikTheOnebrianstormmissmadeleinegeek4lifeboobisputniksweetheartfafnirscavemonimichsippinglifeTeenageDirtbagsuicidelandscapefancy-clapskonicieszesiekonotorimkaynoagazdakornmaedchenavaritiagaborglupiasukacarlandlouiseinsanedreamerusagiimurdercuterapeMigotliwapartyhardorgtfomanuleinblahBincsmdelRayokahaluvDarkDreamzooziasbguysblaxkseoullinandrillaissaykodokudefying-gravitymarvellousblackmoth7halyscircuspantadeuszmakingmoviesczeresniebloodywristsanimeacidevildoro456lubiezoltyalbognijfrogaholicpeculiar-cathahathalszka12irokichigaiLazhwardpesymistalittledarlingwrajtszyderaBloodMooncojapaczenelabaibiiancadrumkarollittleproblemsniezkafluorescentadolescenthonigwurmwrobelekmariolafascinatedmoritazaganskyavocadotreepmglittlegreygirlcaligulatocoulotnesvndeadlysinsto-nieistotneloozikerthatneverhappenedethielHerbatoholiczkafrittatensuppebet91pimpmyheartdoesntsaysomethingtrustno1monroewiecznamonroemakemewannadieKotokosaintsandnanapushbadalenaMaR2-D2try2beunusualfiligranovahisteramargootak-czekamantoninaveritas1emmaleadMrWaspunenlaaaksohysteryczkahplovecraft

May 01 2013



I adore the way Ice King says party.

April 22 2013

Margaret - Thank You Very Much
This is the downside of having nudist parents & relatives

April 21 2013


January 12 2013


so I’m trying to study, but I keep getting distracted by this acetylcholinesterase enzyme because it just looks like it’s having so much fun


every time I switch tabs it’s like BAM SURPRISE ENZYME PARTY

Nobody parties like enzymes
Reposted byOrangeandwhiteOleanderrazorbladeshumer1213

January 01 2013

Reposted bykumikoihearvoicesskomplikowanieprzytulankiSic616katerpanafaxzooziaallyouneedissoupmisery000uncoorestesgaolinsomebunnyAlekwaszapalenieosierdziamrautynamonimichbiiancaMorgulrepostedfromskrzfridgeno-longer-korebirthday-songmalinowykisielmaraskowadeathisjustafeelingeffodienssepulcrumwhodarefloorencemagdulumbeltanetwice9thoctoberkilkaobsesjiwelocypedsstefaniabedazzlementwellanuszkawawuschelcuilwarthien666crystalllshampainperkelewodolankakocikapucbrovinskyczleksobotniwaitingfortheguideredheadladybudasburakotkamamadynia84astedwaethe-new-beyoncekabliukainelafenishafutureiscomingmozgmnieniebolimalvaeslovaMaR2-D2bawelnianagralakowazombikczeresnieczachadymitamaraffemuminulsmigamyniesmiertelnabrzoskwinkacricettalatusekszczerbatyszczurekblyskcheshiresmilemariMomariolaarachnephobicnirvana27666windingroadssilimaginarykeithpeligrofrylongvomitingchangemylifetru-skawkalajlalajlalajlaune-raconteusetildeCrazyAntinsanedreamertakemeoutkumikouskidsknowWekssomethingstupidmrdonadoniiDieKleineMybiscuittesamozatruciebangbangyouredeadjointskurwysynsomebunny666thlongvomitingcholerafrauvermeeremciumakingmovies60Blifeebagherawerandaaatkagrandmapeppafatuhomoludensred-trainerszielonomonimichpannanpudddingnevermorefuckitkasiulaRekrut-Kmoominsilovegreenpeculiar-catnattalygniewosadkatoniewszystkoiammoodyezermalinowykisielgeraltisnotcominghomebawelnianamariolabloodywristsarachnephobictoxicsoulMeeresbrautbradypuseldriannecaptainsebrasfetercheshiresmileumieranko

December 23 2012

September House & Garden part 3.
Pink & green are pretty.
Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!
