Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

May 19 2015



Our precious jewels cannot wait to make their way up the Cannes Film Festival Red Carpet.

Reposted byavaritiamatussmole-w-filizance

March 12 2015


March 05 2015

January 28 2015

4985 5e68


this is terrifying and beautiful at the same time

Reposted byZuruiLogHiMaasiekxpjawn-palacetinderstickkoszmarekMrCoffe

January 27 2015


October 20 2014


and in that moment I swear... we were all moths

Reposted bycomicsgeek4lifegeek4life

August 30 2014

3289 839d





Glass headstones

Imagine a graveyard full of these on a sunny day. It would be so beautiful.

I would position mine so that every day when the sun was in the right position it would set fire to the roof of someone I hated, thus achieving revenge from beyond the grave every single day.

There are two kinds of people

Reposted byp125p856pathetic8linasakuraaizuim-so-retardedchowderwoodynookro-kokoadharanaichconsensualnonconsentjalokim0getstonedmarcziLordelliottPachadilotterlebenbollabollaminnalordminxfourthaddictionschaafmanxxg33kyblindtextextrembuntJaanis93disappointmentJamesEvansTiffanysVermillionzoraxszpaqusSaper300amaruslifucukierekdanielbohrerCatLovesRicesicksinInsliaRayawalkingchaoslost-in-spacechlodnawdowafrequenzwasseravaritiafutureiscominganonimowaDingodoodlcongreveShingomurDerOrwischerrandoomp0rnoopuszekKryptoniteCatLovesRicefrittatensuppewonkostraycatqbshtallaperturemrpaffadenbskillzmcflytrumienkaathaliskaktukthxyAronfrunemankaasiekkxvampiracandice

August 20 2014


Miki Montllo ARTWORK & STUFF:

A lighting study which came out as a result of the last Q&A session at CGMA Academy, featuring Kowalski.

Reposted byTomred97bmp

August 16 2014

4954 6eae




Every morning the light comes in and my toilet looks beautiful

holy shit

Please tell me that was an intentional pun

Reposted bythepunnerynaichPachadiavgpTullfrogvolldostkaheiwojtatichgaself-destructivelittlegirlpanienkamorganita

August 04 2014

8492 d2ba 500


Graphene Aerogel
— Lightest Solid Material Ever Developed

Because aerogels are porous they are ultra-light materials and this one is 100 times lighter than Polystyrene foam cups and can help clean up pollutants like toluene and crude oil (other oils as well) and other compounds like ethanol. Researchers are planning  to look at the materials ability for insulating and sound proofing in the future.

Previous records for lightest materials were 0.9 milligrams per cubic centimeter in 2011, 0.18 mg/cm3 in 2012, and now this material at 0.16 mg/cm3.

Prof. Gao Chao // Polymer Science Engineering at Zhejiang University
Published Feb 18, 2013 // Advanced Materials

Reposted byhappykokeshijawn-palaceLee-FlowskyjestjuzwiosnaschottladenmolotovcupcakeKurkaWyluzujimposterloozikermarczimischgaadmnNoizabladzikweirdscenesinsidethegoldminepanpancernytimecodeablj0evolldostwhovilleJoschIsAGeekdantemplateijakooloetigernobodylikesyousmall-town-girlSam90niepotrzebnaprzygodaawezonePorcelain

May 20 2014

9222 05b7






I fucking love this.

I watched this for like 5 minutes

You guys realize that the length of their stride is indicative of that color’s wavelength right- red being the longest visible and blue one of the shortest. 

Reposted bygifluvprosiaczekkSarielTheCrimsonIdolcorallinepanienkamorganitapytqQueenOfSharksKik4smsbqperditumestrainbowslunaPoxerschlachtorostytekmole-w-filizancelost-in-spacevertheersfmgaweckagafKyujuuSirenensanglychnisBincsmklijuavgpryskaKurkaWyluzujohhwellradaetykiTeereaxannabellepartyhardorgtfoPinkCoffeekapitandziwnymynniajv6rosewhiffxxcongrevetackgnolsilmepulczynskiro-kokoadremaras1024strohmigieeradetwojkotNorkNorkcaptainsebraflubbJuneDownVixelchupacabramuertoPitchMrrrukjarlaxleablmozgmnieniebolithor7oninjamonkeyverdantforceedcWmakrosDieKleineMyjchigoollbugieKACHAcocciuelladzonysstefaniamalinowychrusniakdatingsuppeblkidatrantapatrzpodnogimfmfmfbrianstormNayupetrygoretsomeonelikemenienieniedianka66v3bsosomethingpositivePachadiKudlatyBlueskonotorimusztardalolufomanddaaliceskoszmarekhorstianejokkatzenpongmaeiszmaragdowykotDTDSRinteressiert-mich-netachaiafabiancooksmaoamhaptashairinmyLeMightyMustachediebitchdiederschneikapitandziwny

December 06 2013


*sunlight hits your laptop screen*


every piece of dust in the world

it’s here

(Source: harry2016)

November 18 2013

5296 8f11


I love how behind every single window, there is a different person who has a story that we know nothing about and I sometimes forget that my life isn’t the only life in the world and yeah idk

Reposted frominnocent-whisper innocent-whisper viamau5y mau5y

November 04 2013


An Aerial Kinetic Sculpture with 256 Helium Balloons Embedded with LEDs

Cyclique was an aerial light and sound installation created by audiovisual artist Nohista and Collectif Coin forNuit Blanche 2013 (previously). The array of 256 large white balloons was embedded with LEDs that blinked in sequence with various audio tracks and was further enhanced by the impact of wind which altered the layout and motion of the piece.
Reposted bytrafopop trafopop

October 01 2013


August 30 2013

Reposted bylanuchpesymistadomqeSweetRoseszsoberunicornsofdoomssssssstefaniasniezkaAndii-VliveattherainbowturiongordinbrianstormFifFreXxXbng123zachlannyd3vilwitamkelenavaritiaMollygerdistanPewPowmrpafzupkazproszkusavorschlachtorosrainbowzombieskilledmyunicornlefuwhatteverChlebekkadreiVinrolianuszkaRayastraycatDTDSRFlypntymkafallendebilvslemkoveSam90NeutrumKryptonitewannabezademdarksihayapmglittledinalifesuckswezsplynfuckyoulittleMargoliuszaperturemurzyn44Otacon32ArsenRNoCinderellaxjoancatherinegaftroublesinparadisePsychoTheRapistMagicMethylGronostajGadatliwykasiakjethramonkeyvaultallinoneathalislejibetHoazldoenermayrosecyronissoadystadrayashalossosmasterofpuppetsbeltanegralakowaTodeswalzamissmadeleinecobra0503getstonedoutofmyheadSchubiininatomashevskathrill-killersfmlordhelmofonconsensualnonconsentembracegrishapanienkamorganitaulaschwarzematerieAdikTheOnecongreveinsanelifeczachadyminiedopowiedzeniagoraca-czekoladaiillusiiontr4nt0rthe-devil-insidenvmhubikjalokim0sqampymorbidzoeniesschottladenmsmcgheec1oudyboladesabaomizukaReeshTHE6pyzamazowieckakarwaPsaikot2kvitalyausitalyleelahdotmariusznaxilosnesraitforgetthtwins4everbinocentricz-jakiej-racjidrink-me13-daysdashiirrespectiveripencjohereitcomesarezkuroinekochrisZombieGigolobeqbudassunshines4mezideshowbobcoloredgrayscalezoraxZuruikoskossblaxkseoultuleleimpostergruetzetoxicsoularachnephobicnoisetalesaVoXadmnwrite-url-herefadenbjbeanhoudakotkevblastmkaynoaLaFoiofferamarusGantarhgnfpletzgilbstervanityasphantixJoschIsAGeekfreddykruegerWeksDariuszBananaRamanordernjiskatrumienkaOhSnapSakerosmishastaKnorketichgaeklerrkatrikkschmiddiehurrazarazwracamotworzwrotaryskaangeliqueefiffeyZirconbercikckisbackszczawiowazjajkiemaniironridiculousdreamsdobbydrinkmysoulniespodziewankaKeksverpackungpochehappymealSmokehead18yloozikerkhabarakhforgetdivibmpnetism0k1nggnusucznikwithmyheadinspacedieselmowerhahatmotherofdragonsslowonaniedzielewarkoczbehciokozikozgiltleyankinmarbearearterAnneBonnyFate46frxlofijigglybrojackaloppedaswarkeinhuhnlolufobarricaderugiaDas-huepfende-Kommaskillzmcflyfluorescentadolescentnilsfboseytrustno1orangeskyim-so-retardedanitaisepmonsieurgateaukiksirylanelectricityscapeepheeMarconslovanaichjestnamdzisiajsmutnovoisardtawjazzujarisoredwondergeek4lifefutureiscoming-MacekpsikusreneMissDeWordeboombumDerOrwischermetanoizemetanoizeplateauwisniowysadkociesercenewbeginningmucciafriquel3ftikundelkatastrofowhippedcream92insomniiastiopa46vennectonostalgiaaniolaSmigolv3bsoxannrickmillermusztardacojapaczeneveralonedrseilzugagrestibezanomaliafutureiscominghuggybeargaszkazzuuookanikanicondensatorkillerklown

August 26 2013

Play fullscreen
nature video:

Singing Stars

Scientists have turned light signals from distant stars into sound. By analysing the amount of hiss in the sound, they can work out the star's surface gravity and what stage it's at in its evolution from dwarf to red giant.

Read the research paper: http://dx.doi.org/10.1038/nature12419

August 21 2013








I heard you were talkin’ shit

(via ithinkcoolsvillesucks)

Reposted bynoomixannlost-in-spacesattennikam

August 17 2013


August 12 2013

Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!
