Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

October 21 2017

the latest horror movie coming to screens near you

drew this on Sketchbook Pro, since some friends in the office have red hoodies as well. It was supposed to be a cute drawing but halfway it got kind of creepy so i went with the smudged writing.

L-R: Kristina, me, Ribka, Indah, Renny
si Jun

done in Sketchbook Pro. dang the pen & pencil rendering is realistic af, i couldve submitted this as an Inktober piece

July 07 2015

0188 dada 500


"Thank you loud mobile heat pack for making me this lovely hammock"

June 27 2015




“you’re an adult now”


“you need to choose a career”


“you need to make your own doctor’s appointment”

Reposted fromShadowgirl230 Shadowgirl230

March 28 2015


November 28 2014

8687 2216 500
I just had to, cuz Elly said she went for dinner with Ili while Ili is still in the office. Then she told us the Ili doppleganger has panda eyes. And a few moments later Tina told me she had panda eyes cuz she was tired and I went like "go join the panda eyes crew with Ili" and then suddenly panda hoodie jammies

October 29 2014


September 25 2014



we went upstate and my dog was being a butt and trying to swipe at fish in the lake and she fell in and when we dried her off she was still shivering so i put a sweater on her 

Reposted bymstrzTomred97self-destructivelittlegirljeauvlaursoSad

September 17 2014



background is from the intro sequence

"imagine "X" in a hoodie and short-shorts" yes, ok!!

August 21 2014

7045 050b


the sacrifice is ready

Reposted byTullfrogkociolekorangeugartetichgawhookeyschlachtoroselentarienaichchickpeaEdgihornypigeonkartoNikflawlessunsteadyshythor7oSebeczekOsorkoniusMindlessnezcaferocknrollqueenHypothermiavertheerBincsmatrantaPsaikosoadystaSpinNE555madhatterjawn-palaceKudlatyBlueseatglitterrmoepiangusiastyagatonikozikozKazeKashisowiazupaecblackAnnetteVictoriacheathaKeksverpackungyetztVanillaGorillaHorayNareajosefinemetanoizeToshioTVsmoke11molAeccreohornypigeongodcake2093krybusSmigolcollageankadomitrzdupabladadeleinJaanis93jotccesusansthebestshitIneedthesoupagainmagolek22enna-musicantonimdarthsadicwhovilleReeshTHE6aperturegurtosTomred97sattentrikklolufokarrolkazombiekraskokatzenpongmfmfmfmkaynoal3ftikaieebrightbyte

March 29 2014



hoodies are very important to me

Reposted bywongabuhdianitajosefineCarridwenadmnextrembuntDTDSRredemptionsongsunearthedapparatusfreewayranikoniecznieEveFranciscoyoungandstupidnefertari180TiffanysNorkNorkstraycatschaafpulegonvampirasplinterpierainbowzombieskilledmyunicornstrayavgpNishiou92mynniabong0wonkoArkelanfallnobodylikesyouorangeugarteBananaRamakrybusmissmadeleineTullfrogmolotovcupcakekahaluvserenitetheSilenceAFKaroDredquinneevangelynwtfpanteragifluvollYarrickTammycellvertheerIMSgruetzefuckyoulittleEineFragevonStilavaritiakaddigaborUntergrundbrotlordminxNeruzalcandicexjoancatherineayameneunundneunzigBincsmRekrut-KRRichiefrittatensuppelambdaKomatsuKomatsuarabusadremdicoune-raconteusewerhamsterpatrzpodnogicocciuellaleftandrightDieKleineMyhorstianeTabslacoloredgrayscalesignalpiebalubradypusmisseccentricn0gMissDeWordeTokyoMEWShexxepartyhardorgtfopesymistarainbowzombieskilledmyunicornchowderblackmoth7montakBrainystragglerannebananneBedikorootikthtwins4everepheeininasofiasm303hanseakmonidesresocjalizatorcarlandlouisehannesenemSirenensangHorayNareastarbugnordernSoulPLRudeGirlMollyathalisarisolexxieczinokfarthenLifelineekeliasperitusllankruSeekDantejustpartofmespinatlasagnenutzatrantashlomoStadtgespenstizzy13violinzzPewPowszararandomuserstraycatsplinterpierepluggedherr-samsagiveupgetdroppedPorcelainnutellaPandaAttackdol-blathannareloveutionlordofdragonssaras1024arachnephobicschlachtorosshitty-lovemevgaf

December 10 2013

0630 660d


My brother came into my room like this and said “I’m making some changes in my life”

Reposted bymole-w-filizance mole-w-filizance

December 04 2013


March 01 2013


January 25 2013

6422 6f10
Power Ranger hoodies!
Reposted byiluoktakneelingsolvesproblemsdeniandupabladaRekrut-KmynvschbuttscratcherAgnesvolmonimichSpecies5618comeherebrzysiaTheOtherRugia

October 20 2012

2001 cab9 500
Meanwhile in Ukraine post-office
(via 9GAG)
Reposted bypedosoupmsbqpascalmhavaritiawandiRekrut-KWekswilczalvcksatrantacornisbnanavertheerSpinNE555boxcathappykokeshikiolkacoloredgrayscaleBartolomeobrightbyteVinrolirenegackapkz451jatutylkorepostujeKhollenbstinksZirconininaoscarioschlachtorosglamRayarzekomy9thoctoberakashgrubyfridgeJo-lisaJohannRapPlmonimichwonderlustqueencellhannajoneysm0k1nggnureloveutionmolrenanafromheretoeternitygarethbrownmkaynoaZueschobialasmiercrobaczekharadayfrittatensuppekonianimeacididz-pan-w-cholereklartthrill-killerdeleinkokolokolonecontroversialdatenwolfescadadecarabiaexitorangescythicalmonkeyvaultbigbasticygi-chanlolufokrannixkrybushurtowniazwiruyaccincarlandlouisedominikmradaetykiAlwaysMealanduakaretishkahaberolljankomuzykvolshiaraenajulasekemmaleadpsygateviceerepheeomnipotence-ltdMrsEvezgrydziopilkunnussijastraycatsucznikKwisatzHaderachkikinkidupabladamissmadeleineSpecies5618MrCoffeakisameineedtostealthisDowdlesgroeschtlmynniamarbeargusta-blurugiadatingsuppetrikktronrocknrollqueenhubikleftandrightscorpixelectricityscapenicapicellaquintasanantonimnekharamuertopmgtowososnacondensatorenna-musicv3bsoshit-fuck-satan-death-sex-drugs-rapebnanadodomudalekoatrantajeyjeyjeyTomred97MyBlackWingsswaczynaKurkaWyluzujedhellgrubyimpostermacounnaichambiguouskamakamajestjuzwiosnachoreraelentarieewilRudadredkaminnamurzyn44M3lk0rmagratasiunka2991ulakaszebikarielcommendanterazielinidudantonawkwardkannsdennwahrseintaniazupadladwojgaslovakanusianocnatesciowaertai666niepytajminnafancy-clapsxypusnadalyeirenaswaczynaDariuszckisbackHypothermiaSebeczeksmoke11spizowyratlerdrayashaDiviusanythingrainbowzombieskilledmyunicornTehawankaconsensualnonconsentDagarhengetstonedTodeswalzapankamienjalokim0Tullfrogszatanus-diabelosschottladen

June 01 2012

The babybirds owl hoodie
Reposted bycynamonmartitigreenrose

April 27 2012


giveaway aah

ok so me and my friend laura are doing this giveaway b/c we have loads of stuff lying around like laura has loads of cds she doesnt need any more because of itunes etc etc so we thought we would give it away b/c u guys rock 

ok so you could win

  • a signed panic picture ((signed by dallon ian spencer and brendon and its real because zack gave it to laura and she got two so))
  • a limited edition panic poster which was only available from the uk tour earlier this year
  • a really old kerrang from july 2006 with a big interview and pictures which they all look really hot in
  • a green day hoodie which is so awesome but too small for laura now :-(
  • cds from fall out boy, paramore, you me at six and my chemical romance 

ok cool awesome wait there are rules 

  • reblog as many times as you want but dont make a blog just for the giveaway because thats lame!!
  • likes do count 
  • you have to follow us both lmao um http://dallonweekes.tumblr.com/ and http://gabesaportaspenis.tumblr.com/ 
  • b/c long giveaways suck this one is only going to be two weeks long so it ends on the 27th april yay
  • we’ll choose the winner using a random number generator so it’s all fair and stuff

good luck etc ah :-)

ps we’re not faggots who do fake giveaways lol so we’re not lying ok

DUDE if only I know how to buy stuff online I'd grab these.

April 15 2012


April 10 2012


Hoodies made from blow-up dolls

Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!
